PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008242947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 659aa    MW: 72388.4 Da    PI: 5.5081
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008242947.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.46.9e-28212265155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W++eLH +Fv av+qL G e+A+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  XP_008242947.1 212 KPRVVWSKELHGKFVAAVHQL-GLERAVPKKILDLMNVQGLTRENVASHLQKYRL 265
                     79*******************.********************************7 PP

2Response_reg84.24.1e-28261341109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ ++ll+ +l++ +y +v++++++ eal +l+e++  +Dl+++D++mp+mdG++ll+ +  e  +lp+i++++h+++e++ + +  G
  XP_008242947.1  26 VLAVDDNPICLRLLEGLLQNCQY-QVTTTTQAVEALLMLRESRnrFDLVITDVSMPDMDGFKLLELLGLEM-DLPVIMLSGHSDKELVMKGIAHG 118
                     799********************.9**************999889*********************96644.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel++
  XP_008242947.1 119 ACDYLLKPVRKEELTN 134
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.1E-1601659IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.8E-4323165No hitNo description
SuperFamilySSF521721.57E-3623146IPR011006CheY-like superfamily
SMARTSM004482.9E-3324136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.59725140IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.9E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.04E-2927140No hitNo description
SuperFamilySSF466893.94E-19209269IPR009057Homeodomain-like
PROSITE profilePS5129411.3209268IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-29210269IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-24212265IPR006447Myb domain, plants
PfamPF002491.8E-7214264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MTVKAQRGGL VGEDGAMDRF PVGMRVLAVD DNPICLRLLE GLLQNCQYQV TTTTQAVEAL  60
LMLRESRNRF DLVITDVSMP DMDGFKLLEL LGLEMDLPVI MLSGHSDKEL VMKGIAHGAC  120
DYLLKPVRKE ELTNIWQHVI RRKKFDSKDQ NKSSSQDKAC HETGEGGQGV SPAGSSDQNG  180
KFNRKRKDQN EDEEEEYEDD EHENEDPSTQ KKPRVVWSKE LHGKFVAAVH QLGLERAVPK  240
KILDLMNVQG LTRENVASHL QKYRLCLKRL SSTATQQASM VAAFGGKDSS YMRMGALDGF  300
GDLRSLAGSR RLSNATFSPY APGGMLGRLN SPAGLSIRGI TSSGLVQPGH SQNLSNSISN  360
LVKLQPALPA NQSPNLYESI PTSLELNQLQ QGKHTAHIGE SNPNNDPTSY SVPSSFPDTS  420
VSVSSIHSDS ITSSSPLILH RNPQQALGMG VFGNRSSLSL ASLNPESFDI GISSNFLDDN  480
RCSESWQVAV QLSKFPSNDL PMSPAAELRG NMWNQEGLIG DVVPTMDCTP KQRWEEHKRD  540
YDHNLNLTFS ATNPTVSANV IVSPLSQSLD QSDAVCSKKM NSTLFDQLNG AAPTVMQLSE  600
VEKAAMGTKM KPSEDYPWEQ TKSHDGLVQN SYESLNDIMG AIMKGGQNEN MLMDGEFWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-26208271164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008242947.10.0PREDICTED: two-component response regulator ARR12 isoform X4
SwissprotQ6K8X61e-129ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLM5WH030.0M5WH03_PRUPE; Uncharacterized protein
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-101response regulator 12